PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01843.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 423aa    MW: 47950.8 Da    PI: 8.6029
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01843.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.62.9e-15671402298
                              H.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                       B3  22 faeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                              f+++h +g + +++t +l++ +s ++Wevk   +   gr  lt+GWkeF+ a++L++gD+++F+l+++++f  +v++f 
  Rsa1.0_01843.1_g00010.1  67 FFSKHiQGRNDQKTTAKLRSdTSEKTWEVKK--TEDEGR-RLTDGWKEFALAHDLRVGDVLIFRLEKDMTF--HVTLFG 140
                              667777666778899999997888*******..555555.69***********************999999..998885 PP

2B3634.6e-20190273895
                              -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                       B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                              +++l+ + l lp +f++++g++++++ +++l++e+grsW+++l+  ++ gr  +t+GWk+F + ngLk+gD ++Fkl++r  +  +
  Rsa1.0_01843.1_g00010.1 190 PSTLRYDSLNLPMSFVRANGLETRCG-EIVLMNEKGRSWTLTLK-PRQCGRSRITGGWKGFFSVNGLKAGDLFTFKLIKRGAT--L 271
                              67788899*************99887.****************4.44445589************************996444..3 PP

                              EE CS
                       B3  94 vk 95 
                              v 
  Rsa1.0_01843.1_g00010.1 272 VL 273
                              43 PP

3B359.75.1e-19327421199
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                              f++ ++++++ ++++l lpk+f++ hg+    +++++l d++g +W  kl  r  s+r+ +++GWk+F kan +k+g+++ +kl++
  Rsa1.0_01843.1_g00010.1 327 FVTLTLKPYNVTKCILFLPKPFTDLHGIT--VGTKMSLLDKQGVKWCTKL--RSESKRIRMAGGWKDFFKANCVKTGESIKLKLIW 408
                              67788899***************999876..4569***************..********************************** PP

                              SSEE..EEEEE-S CS
                       B3  87 rsefelvvkvfrk 99 
                              ++++++v+k+++k
  Rsa1.0_01843.1_g00010.1 409 EDDTSCVLKFYSK 421
                              9999999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.91439142IPR003340B3 DNA binding domain
SMARTSM010198.2E-1353142IPR003340B3 DNA binding domain
CDDcd100178.95E-1464139No hitNo description
PfamPF023629.5E-1167139IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.0E-2073152IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-1680149IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.4E-22177276IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.03E-19177276IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.256183278IPR003340B3 DNA binding domain
SMARTSM010197.8E-23184279IPR003340B3 DNA binding domain
PfamPF023622.3E-18190273IPR003340B3 DNA binding domain
CDDcd100171.63E-19191275No hitNo description
Gene3DG3DSA:2.40.330.102.0E-17319418IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.75E-18325414IPR015300DNA-binding pseudobarrel domain
CDDcd100176.55E-15326418No hitNo description
PfamPF023621.1E-16327421IPR003340B3 DNA binding domain
SMARTSM010192.0E-23327422IPR003340B3 DNA binding domain
PROSITE profilePS5086313.098327422IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MISQNQESKP ETKIVPRFGL SVENKGEEKM VMMKEMPAGV EFTDDSENGQ ETFLAAPSSW  60
LPHSLAFFSK HIQGRNDQKT TAKLRSDTSE KTWEVKKTED EGRRLTDGWK EFALAHDLRV  120
GDVLIFRLEK DMTFHVTLFG PSCCEIQYDS SCLADKNNIQ RKINLKKKNP KREAECSSSD  180
PSCFLGNVMP STLRYDSLNL PMSFVRANGL ETRCGEIVLM NEKGRSWTLT LKPRQCGRSR  240
ITGGWKGFFS VNGLKAGDLF TFKLIKRGAT LVLLLKSPSQ EDEGSEADEE IESLSTESDS  300
HDEESNQDEK RRISIWKASS SPSLNRFVTL TLKPYNVTKC ILFLPKPFTD LHGITVGTKM  360
SLLDKQGVKW CTKLRSESKR IRMAGGWKDF FKANCVKTGE SIKLKLIWED DTSCVLKFYS  420
KVE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894331e-116AC189433.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068H20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013746597.10.0PREDICTED: B3 domain-containing protein REM14-like
SwissprotQ8GYM41e-90REM14_ARATH; B3 domain-containing protein REM14
TrEMBLA0A078D6N10.0A0A078D6N1_BRANA; BnaA03g14600D protein
STRINGBra022855.1-P1e-152(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.12e-87B3 family protein